TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 215-245 amino acids from the Central region of human TGIF1 |
TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 215-245 amino acids from the Central region of human TGIF1 |
TGIF (TGIF1) (Center) rabbit polyclonal antibody, Purified
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 152-182 amino acids from the Central region of human TGIF1 |
Rabbit Polyclonal Anti-TGIF1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGIF1 antibody: synthetic peptide directed towards the C terminal of human TGIF1. Synthetic peptide located within the following region: GQNTDIQQIAAKNFTDTSLMYPEDTCKSGPSTNTQSGLFNTPPPTPPDLN |