Rabbit Polyclonal Anti-SSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SSB |
Rabbit Polyclonal Anti-SSB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SSB |
Anti-SSB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 100-105 amino acids of human Sjogren syndrome antigen B (autoantigen La) |
Anti-SSB Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 100-105 amino acids of human Sjogren syndrome antigen B (autoantigen La) |
Rabbit Polyclonal Anti-SNRPD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SNRPD1 antibody: synthetic peptide directed towards the N terminal of human SNRPD1. Synthetic peptide located within the following region: NGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL |
SSB rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 331-380 of Human SSB. |