Anti-NPY1R rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1 |
Anti-NPY1R rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1 |
Rabbit Polyclonal Anti-NPY1R Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NPY1R antibody: synthetic peptide directed towards the middle region of human NPY1R. Synthetic peptide located within the following region: TDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFI |
Rabbit Polyclonal Anti-Neuropeptide Y1 Receptor
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)RLKRRNNMMDKMRDNK, corresponding to amino acid residues 237-252 of human NPY1R. 3rd intracellular loop. |
NPY1R (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide mapping at the C-terminal of human NPY1R |