Antibodies

Jump to Filters
View as table Download
Smoothened (SMO) Rabbit Polyclonal Antibody
TA322573

USD 380.00

In Stock

Anti-SMO Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 772-787 amino acids of human smoothened, frizzled family receptor
Sonic Hedgehog (SHH) Rabbit Polyclonal Antibody
TA334657

USD 539.00

5 Days

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Human, Mouse, Chicken
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT