Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CDC34 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human CDC34

Rabbit anti-CDC34 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC34

Rabbit Polyclonal Anti-CDC34 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDC34 antibody: synthetic peptide directed towards the middle region of human CDC34. Synthetic peptide located within the following region: TLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEE

Rabbit anti CDC34 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated