Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to TC21 (related RAS viral (r-ras) oncogene homolog 2)

Applications IHC, WB
Reactivities Human, Mouse (Predicted: Rat, Bovine, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 204 of TC21 (Uniprot ID#P62070)

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human RRAS2

Rabbit Polyclonal RRAS2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Rabbit polyclonal RRAS2 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human RRAS2.

Rabbit Polyclonal Anti-RRAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RRAS2 antibody is: synthetic peptide directed towards the C-terminal region of Human RRAS2. Synthetic peptide located within the following region: EASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF