Primary Antibodies

View as table Download

CYP7B1 mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP7B1 mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP7B1 mouse monoclonal antibody,clone OTI1G7, Biotinylated

Applications IHC, WB
Reactivities Human
Conjugation Biotin

CYP7B1 mouse monoclonal antibody,clone OTI1G7, HRP conjugated

Applications IHC, WB
Reactivities Human
Conjugation HRP

CYP7B1 mouse monoclonal antibody,clone OTI1G7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP7B1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal Cytochrome P450 7B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 7B1.

CYP7B1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-YPDSDVLFRYKVKS, from the C Terminus of the protein sequence according to NP_004811.1.

Rabbit Polyclonal Anti-CYP7B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP7B1 antibody: synthetic peptide directed towards the C terminal of human CYP7B1. Synthetic peptide located within the following region: AMYYLLRHPEAMAAVRDEIDRLLQSTGQKKGSGFPIHLTREQLDSLICLE

CYP7B1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CYP7B1