Primary Antibodies

View as table Download

Rabbit polyclonal anti-IPPK antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IPPK.

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.

PLCG2 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCG2

Rabbit Polyclonal Anti-ISYNA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ISYNA1 Antibody: synthetic peptide directed towards the N terminal of human ISYNA1. Synthetic peptide located within the following region: LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN

Rabbit Polyclonal Anti-PLCZ1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PLCZ1

PLCG2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human PLCG2

Rabbit polyclonal anti-PIP5K antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIP5K.

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIP5K1B antibody is: synthetic peptide directed towards the C-terminal region of Human PIP5K1B. Synthetic peptide located within the following region: VFKKIQALKASPSKKRCNSIAALKATSQEIVSSISQEWKDEKRDLLTEGQ

Rabbit Polyclonal Anti-PIK3CD Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3CD

Phospholipase C gamma 1 (PLCG1) pTyr771 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 (P-D-Yp-G-A).

Phospholipase C gamma 1 (PLCG1) pTyr771 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human PLCG1 around the phosphorylation site of Tyrosine 771 (P-D-Yp-G-A).

Phospholipase C beta 3 (PLCB3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated