PLA2G3 mouse monoclonal antibody,clone OTI8G8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLA2G3 mouse monoclonal antibody,clone OTI8G8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLA2G3 mouse monoclonal antibody,clone OTI1F4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLA2G3 mouse monoclonal antibody,clone OTI4F2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI1F4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI4F2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI8G8
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PLA2G3 mouse monoclonal antibody,clone OTI1F4, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
PLA2G3 mouse monoclonal antibody,clone OTI1F4, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
PLA2G3 mouse monoclonal antibody,clone OTI4F2, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
PLA2G3 mouse monoclonal antibody,clone OTI4F2, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
USD 509.00
2 Weeks
PLA2G3 mouse monoclonal antibody,clone OTI8G8, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
PLA2G3 mouse monoclonal antibody,clone OTI8G8, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
PLA2G3 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Gorilla, Human, Monkey, Pig, Gibbon (Predicted: Mouse, Horse, Rabbit) |
Conjugation | Unconjugated |
Immunogen | PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%). |
Rabbit Polyclonal Anti-PLA2G3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS |