USD 224.00
USD 447.00
In Stock
SERPINC1 (Antithrombin III) mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
SERPINC1 (Antithrombin III) mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SERPINC1 mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal SERPINC1 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SERPINC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 364-393 amino acids from the C-terminal region of human SERPINC1. |
USD 509.00
2 Weeks
SERPINC1 (Antithrombin III) mouse monoclonal antibody, clone OTI8D5 (formerly 8D5), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
SERPINC1 (Antithrombin III) mouse monoclonal antibody, clone OTI8D5 (formerly 8D5), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-SERPINC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINC1 antibody: synthetic peptide directed towards the middle region of human SERPINC1. Synthetic peptide located within the following region: ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD |
Rabbit anti-SERPINC1 Polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SERPINC1 |
Rabbit Polyclonal Anti-Serpinc1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Serpinc1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGRVANPCV |
Rabbit anti SERPINC1/AT3(Antithrombin 3) Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the intra domain 160-175aa of human AT3 protein. This sequence is identical to human, mouse, rat, dog, bovine and chicken. |
USD 200.00
2 Days
SERPINC1 (Antithrombin III) mouse monoclonal antibody, clone OTI8D5 (formerly 8D5)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |