Rabbit Polyclonal Anti-MASP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MASP2 |
Rabbit Polyclonal Anti-MASP2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MASP2 |
Rabbit Polyclonal Anti-Masp2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT |