Primary Antibodies

View as table Download

NEGR1 mouse monoclonal antibody,clone OTI3G8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEGR1 mouse monoclonal antibody,clone OTI3G8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NEGR1 mouse monoclonal antibody,clone OTI3G8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-NEGR1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NEGR1.

Rabbit polyclonal Anti-NEGR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEGR1 antibody: synthetic peptide directed towards the N terminal of human NEGR1. Synthetic peptide located within the following region: WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSV