PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
PPP3CA mouse monoclonal antibody,clone OTI5C6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
PPP3CA mouse monoclonal antibody,clone OTI5C6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | HRP |
Rabbit Polyclonal Anti-PPP3CA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPP3CA |
PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Rat, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PPP3CA
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE |
Rabbit Polyclonal Anti-PPP3CA
Applications | WB |
Reactivities | Mouse, Rat, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL |
Calcineurin A (PPP3CA) mouse monoclonal antibody, clone CC-6, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A purified peptide conjugated to KLH |
PPP3CA Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP3CA |