Primary Antibodies

View as table Download

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OR-4F2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit monoclonal anti-Sox2 Antibody, clone OTIR-2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Antibody against SOX2 - Embryonic Stem Cell Marker

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human SOX2 protein (within residues 1-100). [Swiss-Prot# P48431]

Rabbit Polyclonal Antibody against OCT4 - Embryonic Stem Cell Marker

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human OCT4 protein sequence (between residues 100-200).

Rabbit Polyclonal Anti-OTX2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTX2 antibody: synthetic peptide directed towards the N terminal of human OTX2. Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

Rabbit polyclonal KLF4 Antibody (N-term C74)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This KLF4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 69-101 amino acids from the N-terminal region of human KLF4.

WNT3A Rabbit monoclonal antibody,clone OTIR4G6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal anti-DNMT3B antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human DNMT3B.

Rabbit Polyclonal Anti-SOX10 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SOX10 Antibody: synthetic peptide directed towards the middle region of human SOX10. Synthetic peptide located within the following region: PGGEAEQGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPT

Rabbit Polyclonal Anti-CD38 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CD38

Rabbit polyclonal anti-BDNF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli.

Rabbit Polyclonal Anti-WNT3A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human WNT3A

Anti-POU5F1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-150 amino acids of human POU class 5 homeobox 1

Rabbit polyclonal CD38 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Monkey)
Conjugation Unconjugated
Immunogen This CD38 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 241-270 amino acids from the C-terminal region of human CD38.