Anti-FZD6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6 |
Anti-FZD6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 47-60 amino acids of human frizzled family receptor 6 |
Rabbit polyclonal anti-FZD6 antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FZD6. |
Rabbit Polyclonal Anti-FZD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE |