Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK9 |
Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human KCNK9 |
Rabbit Polyclonal Anti-KCNK9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK9 antibody: synthetic peptide directed towards the N terminal of human KCNK9. Synthetic peptide located within the following region: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY |