Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 380.00
4 Weeks
Anti-GRIN2D Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1264-1278 amino acids of Human glutamate receptor, ionotropic, N-methyl D-aspartate 2D |
USD 465.00
3 Weeks
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
Rabbit Polyclonal NMDAR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NMDAR1 |
Rabbit Polyclonal Anti-GRIN2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Families
- Ion Channels: Glutamate Receptors
Pathways
- Calcium signaling pathway