NMDAR2A (GRIN2A) Rabbit Polyclonal Antibody

CAT#: TA338510

Rabbit Polyclonal Anti-GRIN2A Antibody

Product Images

WB Suggested Anti-GRIN2A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Muscle

• 

  Sample Type. Rat Hippocampal Neurons - 14DIVPrimary Antibody Dilution. 1:200 Secondary Antibody. Anti-rabbit-Cy3Secondary Antibody Dilution. 1:500Color/Signal Descriptions. Green: GFP Red: NR2a Yellow: VGLUT12Gene Name. GRIN2ASubmitted by. Dan Fowl

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 163 kDa
• Gene Name: glutamate ionotropic receptor NMDA type subunit 2A
• Database Link:
  NP_000824
  Entrez Gene 24409 RatEntrez Gene 2903 Human
  UniProt ID Q12879
• Background: This gene encodes a member of the glutamate-gated ion channel protein family. The encoded protein is an N-methyl-D-aspartate (NMDA) receptor subunit. NMDA receptors are both ligand-gated and voltage-dependent, and are involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. These receptors are permeable to calcium ions, and activation results in a calcium influx into post-synaptic cells, which results in the activation of several signaling cascades. Disruption of this gene is associated with focal epilepsy and speech disorder with or without mental retardation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
• Synonyms: EPND; FESD; GluN2A; LKS; NMDAR2A; NR2A
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 86%; Pig: 79%; Rat: 79%; Mouse: 79%; Guinea pig: 79%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Glutamate Receptors, Ion Channels: Sodium, Transmembrane
• Protein Pathways: Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Calcium signaling pathway, Long-term potentiation, Neuroactive ligand-receptor interaction, Systemic lupus erythematosus