BMP5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
BMP5 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-BMP5 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG |
BMP5 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BMP5 |