Primary Antibodies

View as table Download

ENOPH1 mouse monoclonal antibody,clone OTI6B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ENOPH1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ENOPH1 mouse monoclonal antibody,clone OTI4A8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI6B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ENOPH1 mouse monoclonal antibody,clone OTI4A8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ENOPH1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the middle region of human ENOPH1. Synthetic peptide located within the following region: TDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSS

Rabbit Polyclonal Anti-ENOPH1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENOPH1 antibody: synthetic peptide directed towards the N terminal of human ENOPH1. Synthetic peptide located within the following region: IEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVD

ENOPH1 mouse monoclonal antibody,clone OTI6B6

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ENOPH1 mouse monoclonal antibody,clone OTI4E1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ENOPH1 mouse monoclonal antibody,clone OTI4A8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated