Primary Antibodies

View as table Download

LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse Monoclonal DNMT3A Antibody (64B1446)

Applications ChIP, CyTOF-ready, FC, ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse Monoclonal DNMT1 Antibody (60B1220.1)

Applications ChIP, CyTOF-ready, FC, ICC/IF, IHC, IP, Simple Western, WB
Reactivities Human, Mouse, Zebrafish
Conjugation Unconjugated

Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody

Applications ELISA, FC, ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338]

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated