Rabbit Polyclonal Anti-WNT8B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT8B |
Rabbit Polyclonal Anti-WNT8B Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human WNT8B |
WNT8B / Wnt 8b Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse |
Conjugation | Unconjugated |
Immunogen | WNT8B / Wnt 8b antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Dog, Bovine, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig (100%); Opossum, Platypus (94%); Marmoset (88%). |
Rabbit Polyclonal Anti-WNT8B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-WNT8B Antibody: synthetic peptide directed towards the middle region of human WNT8B. Synthetic peptide located within the following region: KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAG |
Rabbit Polyclonal Anti-WNT8B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT8B antibody: synthetic peptide directed towards the N terminal of human WNT8B. Synthetic peptide located within the following region: QLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG |
WNT8B / Wnt 8b Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Gibbon (Predicted: Monkey, Bat, Dog, Horse, Rabbit) |
Conjugation | Unconjugated |
Immunogen | WNT8B / Wnt 8b antibody was raised against synthetic 17 amino acid peptide from C-Terminus of human WNT8B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Panda (100%); Marmoset, Dog, Bat, Horse, Rabbit (94%); Bovine (88%); Elephant (82%). |
Rabbit Polyclonal Anti-Wnt8b Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Wnt8b Antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: IADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWE |
Rabbit Polyclonal Anti-WNT8B Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Wnt8b antibody is: synthetic peptide directed towards the C-terminal region of Mouse Wnt8b. Synthetic peptide located within the following region: SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR |