Primary Antibodies

View as table Download

Anti-COL4A3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-52 amino acids of human collagen, type IV, alpha 3 (Goodpasture antigen)

Anti-COL4A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1648-1662 amino acids of human collagen, type IV, alpha 1

Anti-COL4A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1648-1662 amino acids of human collagen, type IV, alpha 1

Rabbit Polyclonal Anti-COL4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL4A3 antibody: synthetic peptide directed towards the N terminal of human COL4A3. Synthetic peptide located within the following region: GPPGVPGSPGSSRPGLRGAPGWPGLKGSKGERGRPGKDAMGTPGSPGCAG

Rabbit Polyclonal Anti-COL4A2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human COL4A2

Collagen IV (COL4A1) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Bovine, Human, Mammalian
Conjugation Unconjugated
Immunogen Collagen Type IV from Human and Bovine placenta.

Rabbit polyclonal Collagen IV a5 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen IV a5.

Rabbit polyclonal Collagen IV a3 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen IV a3.

Rabbit polyclonal Collagen IV a4 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Collagen IV a4.

Rabbit polyclonal Collagen IV antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen IV.

Rabbit Polyclonal Anti-COL4A3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-COL4A3 antibody: synthetic peptide directed towards the middle region of human COL4A3. Synthetic peptide located within the following region: DPGQPGPPGEQGPPGRCIEGPRGAQGLPGLNGLKGQQGRRGKTGPKGDPG

Rabbit polyclonal Collagen IV a3 (Cleaved-Pro1426) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen IV a3.

Goat Anti-COL4A3 (aa341-353) Polyclonal Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence C-RGPTEYYDTYQEK, from the internal region of the protein sequence according to NP_000082.2

Rabbit Polyclonal Anti-Collagen IV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Collagen IV Antibody: A synthesized peptide derived from human Collagen IV

Rabbit polyclonal Collagen IV a3 (Cleaved-Leu1425) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Collagen IV a3.