Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBP1 |
Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FBP1 |
Rabbit Polyclonal Anti-FBP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FBP1 antibody: synthetic peptide directed towards the N terminal of human FBP1. Synthetic peptide located within the following region: YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA |
Rabbit anti-FBP1 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human FBP1 |