USD 509.00
2 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 509.00
2 Weeks
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
HSPA6 mouse monoclonal antibody, clone OTI1H3 (formerly 1H3)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
HSPA6 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HSPA6 mouse monoclonal antibody, clone OTI1E11 (formerly 1E11)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HSPA6 antibody: synthetic peptide directed towards the middle region of human HSPA6. Synthetic peptide located within the following region: EYEHQKRELEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEV |
HSPA6 mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |