Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DUSP19 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DUSP19

Rabbit polyclonal anti-DUS19 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DUS19.

DUSP19 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-DUSP19 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DUSP19 antibody: synthetic peptide directed towards the C terminal of human DUSP19. Synthetic peptide located within the following region: SEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESNKCDRIQENSS