Anti-DTX3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 248 amino acids of human deltex homolog 3 (Drosophila) |
Anti-DTX3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 248 amino acids of human deltex homolog 3 (Drosophila) |
Anti-DTX3 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 248 amino acids of human deltex homolog 3 (Drosophila) |
Rabbit Polyclonal Anti-Dtx3 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Dtx3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL |