Rabbit polyclonal MASP1 (heavy chain, Cleaved-Arg448) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MASP1. |
Rabbit polyclonal MASP1 (heavy chain, Cleaved-Arg448) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MASP1. |
Rabbit Polyclonal Anti-MASP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MASP1 antibody is: synthetic peptide directed towards the N-terminal region of Human MASP1. Synthetic peptide located within the following region: PGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHN |