Anti-CSNK1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 316-329 amino acids of Human Casein kinase I isoform alpha |
Anti-CSNK1A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 316-329 amino acids of Human Casein kinase I isoform alpha |
Rabbit polyclonal anti-CKI-a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKI-a. |
Casein Kinase 1 alpha (CSNK1A1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Casein Kinase I a (Ab-321) antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Casein Kinase I a around the phosphorylation site of threonine 321 (A-Q-TP-P-T). |
USD 315.00
3 Weeks
Casein Kinase 1 alpha (CSNK1A1) mouse monoclonal antibody, clone AT2E2, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 430.00
3 Weeks
Casein Kinase 1 alpha (CSNK1A1) mouse monoclonal antibody, clone AT2E2, Purified
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Casein Kinase 1 alpha (CSNK1A1) chicken polyclonal antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSNK1A1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CSNK1A1 antibody: synthetic peptide directed towards the C terminal of human CSNK1A1. Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF |
CSNK1A1 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CSNK1A1 |