Rabbit Polyclonal Anti-EPB41L2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EPB41L2 antibody: synthetic peptide directed towards the middle region of human EPB41L2. Synthetic peptide located within the following region: AKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQAST |
Rabbit polyclonal anti-EPB41L2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human EPB41L2. |
Goat Polyclonal Antibody against EPB41L2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RREVRSPTKAPH, from the internal region of the protein sequence according to NP_001422.1. |
Germany
Japan
United Kingdom
China
