MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
5 Days
MRPL13 mouse monoclonal antibody,clone 6A11, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
MRPL13 mouse monoclonal antibody,clone 6A11, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit polyclonal anti-MRPL13 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MRPL13. |
Rabbit Polyclonal Anti-MRPL13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MRPL13 antibody: synthetic peptide directed towards the middle region of human MRPL13. Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD |
MRPL13 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MRPL13 |
MRPL13 mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |