VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
VEGFC mouse monoclonal antibody,clone 4A1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
VEGFC mouse monoclonal antibody,clone 4A1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
VEGFC mouse monoclonal antibody, clone OTI4A1 (formerly 4A1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-VEGFC Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 256-270 amino acids of human vascular endothelial growth factor C |
VEGFC mouse monoclonal antibody, clone 9E7, Purified
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
VEGFC (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human VEGF3 |
Rabbit Polyclonal Anti-VEGFC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VEGFC antibody is: synthetic peptide directed towards the C-terminal region of Human VEGFC. Synthetic peptide located within the following region: LDEETCQCVCRAGLRPASCGPHKELDRNSCQCVCKNKLFPSQCGANREFD |