Rabbit polyclonal anti-STAG3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human STAG3. |
Rabbit polyclonal anti-STAG3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human STAG3. |
Rabbit Polyclonal Anti-STAG3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-STAG3 Antibody: synthetic peptide directed towards the middle region of human STAG3. Synthetic peptide located within the following region: VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS |