Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SEMA6D Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SEMA6D

Rabbit Polyclonal Anti-SEMA6D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D. Synthetic peptide located within the following region: VSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQLMLKIRDTLY

Rabbit Polyclonal Anti-SEMA6D Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEMA6D antibody: synthetic peptide directed towards the N terminal of human SEMA6D. Synthetic peptide located within the following region: KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN