USD 509.00
2 Weeks
GTF2B mouse monoclonal antibody, clone OTI2A1 (formerly 2A1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GTF2B mouse monoclonal antibody, clone OTI2A1 (formerly 2A1), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GTF2B mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GTF2B mouse monoclonal antibody, clone OTI2F5 (formerly 2F5), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
USD 509.00
2 Weeks
GTF2B mouse monoclonal antibody, clone OTI5B6 (formerly 5B6), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 509.00
2 Weeks
GTF2B mouse monoclonal antibody, clone OTI5B6 (formerly 5B6), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit Polyclonal Anti-GTF2B Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFK |
GTF2B mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2B mouse monoclonal antibody, clone OTI2A7 (formerly 2A7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2B mouse monoclonal antibody, clone OTI2A1 (formerly 2A1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2B mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GTF2B mouse monoclonal antibody, clone OTI5B6 (formerly 5B6)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GTF2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the N terminal of human GTF2B. Synthetic peptide located within the following region: ECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIG |
Rabbit Polyclonal Anti-GTF2B Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2B antibody: synthetic peptide directed towards the C terminal of human GTF2B. Synthetic peptide located within the following region: SVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFP |
Mouse Monoclonal TFIIB Antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |