Rabbit Polyclonal Anti-IL22RA2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL22RA2 |
Rabbit Polyclonal Anti-IL22RA2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human IL22RA2 |
Rabbit polyclonal antibody to IL-22R alpha 2 (interleukin 22 receptor, alpha 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 218 of IL22 Receptor alpha 2 |
Rabbit Polyclonal Anti-IL22RA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL22RA2 antibody is: synthetic peptide directed towards the C-terminal region of Human IL22RA2. Synthetic peptide located within the following region: NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE |