IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
Rabbit polyclonal IGFBP2 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human (Predicted: Bovine, Pig) |
Conjugation | Unconjugated |
Immunogen | This IGFBP2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the C-terminal region of human IGFBP2. |
IGFBP2 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal anti-IBP2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human IGFBP2. |
Rabbit Polyclonal Anti-IGFBP2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: KPLKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQ |
Rabbit Polyclonal Anti-IGFBP2 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IGFBP2 Antibody: synthetic peptide directed towards the middle region of human IGFBP2. Synthetic peptide located within the following region: LEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNC |