Rabbit anti mGluR5 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human Glutamate receptor. This sequence is identical to human and rat. |
Rabbit anti mGluR5 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Rat, Rabbit |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human Glutamate receptor. This sequence is identical to human and rat. |
Rabbit anti GluR6/7 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RXFP2 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI |
5HT5A receptor (HTR5A) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
HTR2C rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Growth Hormone (GH1) mouse monoclonal antibody, clone GA-8, Purified
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti-LEP Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LEP |