Primary Antibodies

View as table Download

Rabbit anti mGluR5 Polyclonal Antibody

Applications IHC
Reactivities Human, Rat, Rabbit
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human Glutamate receptor. This sequence is identical to human and rat.

Rabbit anti GluR6/7 Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RXFP2 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the following sequence TEVSVLLLTYLTLEKFLVIVFPFSNIRPGKRQTSVILICIWMAGFLIAVI

5HT5A receptor (HTR5A) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated

HTR2C rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Growth Hormone (GH1) mouse monoclonal antibody, clone GA-8, Purified

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit anti-LEP Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human LEP