GNAS mouse monoclonal antibody,clone OTI7A6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7A6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI13D7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13D7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 224.00
USD 447.00
In Stock
GNAS mouse monoclonal antibody,clone OTI13G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI7H4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GNAS mouse monoclonal antibody,clone OTI13G5
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-GNAS antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GNAS antibody: synthetic peptide directed towards the N terminal of human GNAS. Synthetic peptide located within the following region: SGKSTIVKQMRILHVNGFNGDSEKATKVQDIKNNLKEAIETIVAAMSNLV |
GNAS mouse monoclonal antibody,clone OTI13D7
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7A6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GNAS mouse monoclonal antibody,clone OTI7A4
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal antibody to GNAS (GNAS complex locus)
Applications | IHC, WB |
Reactivities | Human, Mouse (Predicted: Dog, Pig, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 807 and 1037 of GNAS (Uniprot ID#Q5JWF2) |