Primary Antibodies

View as table Download

ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ATG4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG4A

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ATG4B

ATG4B mouse monoclonal antibody,clone OTI1A3

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-ATG4C antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4C.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4B antibody was raised against a 17 amino acid peptide near the carboxy terminus of human ATG4B.

Rabbit Polyclonal Anti-ATG4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL

Rabbit polyclonal anti-ATG4B antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ATG4B.

Rabbit polyclonal anti-ATG4A antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ATG4A.

Rabbit Polyclonal ATG4B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A portion of amino acid 350-400 of human APG4B was used as the immunogen.

Rabbit Polyclonal Anti-ATG4A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG4A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human ATG4A.