Primary Antibodies

View as table Download

Rabbit Polyclonal MUC-1 Antibody

Applications FC, ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.

Rabbit Polyclonal Antibody against LOX

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Rat, Porcine, Cow
Conjugation Unconjugated
Immunogen A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300

Rabbit Polyclonal LOX propeptide Antibody

Applications ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Mouse, Rat, Porcine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of mouse LOX propeptide (residues 78-115). [UniProt# P28301]