Primary Antibodies

View as table Download

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1

Anti-IL1RL1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human interleukin 1 receptor-like 1

Rabbit Polyclonal Anti-IL1RL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL1RL1 antibody: synthetic peptide directed towards the N terminal of human IL1RL1. Synthetic peptide located within the following region: RQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTC

Rabbit Polyclonal IL1RL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 207-238 of human ST2V was used as immunogen, GenBank no BAA85894.