Rabbit Polyclonal Anti-HAL Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET |
Rabbit Polyclonal Anti-CPS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPS1 antibody: synthetic peptide directed towards the N terminal of human CPS1. Synthetic peptide located within the following region: QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL |
Rabbit Polyclonal Anti-CA1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA1 antibody: synthetic peptide directed towards the N terminal of human CA1. Synthetic peptide located within the following region: ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS |
Rabbit Polyclonal Anti-CA8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CA8 antibody: synthetic peptide directed towards the middle region of human CA8. Synthetic peptide located within the following region: TISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Carbonic Anhydrase I (CA1) (Erythrocytes) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Carbonic Anhydrase I isolated and purified from Human Erythrocytes. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit polyclonal anti-CA3 antibody
| Applications | WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA3. |
Rabbit polyclonal anti-CA5A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA5A. |
Rabbit polyclonal anti-CA6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA6. |
Rabbit polyclonal anti-CA5B antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA5B. |
Rabbit polyclonal anti-CA14 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA14. |
Rabbit polyclonal anti-CA13 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CA13. |
GLUD1 Rabbit anti-Bovine Polyclonal Antibody
| Applications | IHC |
| Reactivities | Bovine, Human |
| Conjugation | Unconjugated |
| Immunogen | GLUD1/Glutamate Dehydrogenase antibody was raised against bovine liver glutamate dehydrogenase. |
Anti-CA14 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 26-290 amino acids of human carbonic anhydrase XIV |
Germany
Japan
United Kingdom
China
