Primary Antibodies

View as table Download

RAB27A rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAB27A

Rabbit Polyclonal Anti-RAB27A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAB27A

Rabbit anti-RAB27A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB27A

Rabbit polyclonal Anti-RAB27A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAB27A antibody: synthetic peptide directed towards the middle region of human RAB27A. Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG