Rabbit Polyclonal Anti-FLI1 Antibody
| Applications | WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLI1 antibody: synthetic peptide directed towards the N terminal of human FLI1. Synthetic peptide located within the following region: MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINP |
Amino Acid Arylamidase rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Amino Acid Arylamidase isolated and purified from Porcine kidney. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Amino Acid Arylamidase rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Amino Acid Arylamidase isolated and purified from Porcine kidney. Freund's complete adjuvant is used in the first step of the immunization procedure. |
Amino Acid Arylamidase rabbit polyclonal antibody, Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Amino acid arylamidase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
DAO rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | D-Amino acid oxidase isolated and purified from Porcine kidney. Freund's complete adjuvant is used in the first step of the immunization procedure. |
DAO rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | D-Amino acid oxidase isolated and purified from Porcine kidney. Freund's complete adjuvant is used in the first step of the immunization procedure. |
CS rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Citrate synthase isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CS rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Citrate synthase isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CS rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Citrate synthase isolated and purified from Porcine heart. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
CELA1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Elastase isolated and purified from Porcine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LOC100736962 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Esterase is isolated and purified from Porcine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LOC100736962 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Esterase is isolated and purified from Porcine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
LOC100736962 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Esterase is isolated and purified from Porcine liver. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Fumarase rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
| Immunogen | Fumarase is isolated and purified from Porcine heart Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Fumarase rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Fumarase is isolated and purified from Porcine heart Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Germany
Japan
United Kingdom
China
