Arfgap1 (NM_145760) Mouse Recombinant Protein
CAT#: TP520358
Purified recombinant protein of Mouse ADP-ribosylation factor GTPase activating protein 1 (Arfgap1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "Arfgap1"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR220358 representing NM_145760
Red=Cloning site Green=Tags(s) MASPRTRKVLKEVRAQDENNVCFECGAFNPQWVSVTYGIWICLECSGRHRGLGVHLSFVRSVTMDKWKDI ELEKMKAGGNAKFREFLETQDDYEPSWSLQDKYSSRAAALFRDKVATLAEGKEWSLESSPAQNWTPPQPK TLQFTAHRASGQPQSAAASGDKAFEDWLNDDLGSYQGAQENRYVGFGNTVPPQKREDDFLNNAMSSLYSG WSSFTTGASKFASAAKEGATKFGSQASQKASELGHSLNENVLKPAQEKVKEGRIFDDVSSGVSQLASKVQ GVGSKGWRDVTTFFSGKAEDSSDRPLEGHSYQNSSGDNSQNSNIDQSFWETFGSAEPPKAKSPSSDSWTC ADASTGRRSSDSWDVWGSGSASNNKNSNSDGWESWEGASGEGRAKATKKAAPSTADEGWDNQNW myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_665703 |
Locus ID | 228998 |
UniProt ID | Q9EPJ9 |
Cytogenetics | 2 103.53 cM |
Refseq Size | 2721 |
Refseq ORF | 1242 |
Synonyms | AI115377; Arf1gap |
Summary | GTPase-activating protein (GAP) for the ADP ribosylation factor 1 (ARF1). Involved in membrane trafficking and /or vesicle transport. Promotes hydrolysis of the ARF1-bound GTP and thus, is required for the dissociation of coat proteins from Golgi-derived membranes and vesicles, a prerequisite for vesicle's fusion with target compartment. Probably regulates ARF1-mediated transport via its interaction with the KDELR proteins and TMED2. Overexpression induces the redistribution of the entire Golgi complex to the endoplasmic reticulum, as when ARF1 is deactivated. Its activity is stimulated by phosphoinosides and inhibited by phosphatidylcholine (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.