Nfatc4 (NM_023699) Mouse Recombinant Protein

CAT#: TP511104

Purified recombinant protein of Mouse nuclear factor of activated T cells, cytoplasmic, calcineurin dependent 4 (Nfatc4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug


USD 988.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

USD 471.00

Other products for "Nfatc4"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR211104 representing NM_023699
Red=Cloning site Green=Tags(s)

MGAASCEDEELEFKLVFGEEKEPPPLGPGGPGEELDSEDTPPCCRLALGEPLPYGAAPIGIPRPPPPRPG
MHSPPPRPAPSPGTWESQPARSVRLGGPGGNAGGAGGGRVLECPSIRITSISPTPDPPTSLEDTSETWGD
GSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEAASRFG
LSSPLPSPRASPRPWTPEDPWSLYGPSSGGRAPEDSWLLLSAPGPVPASPRPASPCGKRRYSSSGTPSSA
SPALSRRGSLGEEGPEPPPPPPLPLVRDPSSPGPFDYVGAPPTESIPQKTRRTSSEQAVALPRSEEPPSC
NGKLPSGTEDSVAAPGALRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERSLRPHAFYQVHRITGK
MVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQ
GGGKVVSVQAASVPIECSQRSAQELPQVETYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQW
EEEAAVNRLQSSEVTLTLTIPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFKFLPVVFKEEPLPDSSLRG
FPSTSGPPFGPDVDFSPPRPPYPSYPHEDPAYETPYLSEGFGYSTPALYPQTGPPPSYRSGLRMFPETGG
TTGCARLPSVSFLPRPFPGDQYGGQGSSFALGLPFSPPAPFRPPLPSSPPLEDPFHPQSAIHPLPPEGYN
EVGPGYTPGEGASEQEKARGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPARPGEEPPA

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 95.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_076188
Locus ID 73181
UniProt ID Q8K120
Cytogenetics 14 C3
Refseq Size 3284
Refseq ORF 2703
Synonyms 3110041H08Rik; AW107667; AW546455; Nfat3
Summary Ca(2+)-regulated transcription factor that is involved in several processes, including the development and function of the immune, cardiovascular, musculoskeletal, and nervous systems. Involved in T-cell activation, stimulating the transcription of cytokine genes, including that of IL2 and IL4 (PubMed:17198697). Along with NFATC3, involved in embryonic heart development (PubMed:12750314, PubMed:17198697). Involved in mitochondrial energy metabolism required for cardiac morphogenesis and function (PubMed:12750314). Transactivates many genes involved in heart physiology. Along with GATA4, binds to and activates NPPB/BNP promoter (PubMed:9568714). Activates NPPA/ANP/ANF and MYH7/beta-MHC transcription (By similarity). Binds to and transactivates AGTR2 gene promoter (PubMed:17198697). Involved in the regulation of adult hippocampal neurogenesis. Involved in BDNF-driven pro-survival signaling in hippocampal adult-born neurons. Involved in the formation of long-term spatial memory and long-term potentiation (PubMed:22586092). In cochlear nucleus neurons, may play a role in deafferentation-induced apoptosis during a developmental critical period when auditory neurons depend on afferent input for survival (PubMed:18354019). Binds to and activates the BACE1/Beta-secretase 1 promoter, hence may regulate the proteolytic processing of the amyloid precursor protein (APP). Plays a role in adipocyte differentiation. May be involved in myoblast differentiation into myotubes (By similarity). Binds the consensus DNA sequence 5'-GGAAAAT-3' (Probable). In the presence of CREBBP, activates TNF transcription. Binds to PPARG gene promoter and regulates its activity (By similarity). Binds to PPARG and REG3G gene promoters (PubMed:17198697).[UniProtKB/Swiss-Prot Function]

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.