Serpinb1a (NM_025429) Mouse Recombinant Protein

CAT#: TP505910

Purified recombinant protein of Mouse serine (or cysteine) peptidase inhibitor, clade B, member 1a (Serpinb1a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205910 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEQLSSANTLFALELFQTLNESSPTGNIFFSPFSISSALAMVILGAKGSTAAQLSKTFHFDSVEDIHSRF
  QSLNAEVSKRGASHTLKLANRLYGEKTYNFLPEYLASTQKMYGADLAPVDFLHASEDARKEINQWVKGQT
  EGKIPELLSVGVVDSMTKLVLVNAIYFKGMWEEKFMTEDTTDAPFRLSKKDTKTVKMMYQKKKFPFGYIS
  DLKCKVLEMPYQGGELSMVILLPKDIEDESTGLKKIEKQITLEKLLEWTKRENLEFIDVHVKLPRFKIEE
  SYTLNSNLGRLGVQDLFSSSKADLSGMSGSRDLFISKIVHKSFVEVNEEGTEAAAATGGIATFCMLLPEE
  EFTVDHPFIFFIRHNPTSNVLFLGRVCSP
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 42.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079705
• Locus ID: 66222
• UniProt ID: Q9D154
• Cytogenetics: 13 13.75 cM
• Refseq Size: 1931
• Refseq ORF: 1140
• Synonyms: 1190005M04Rik; AI325983; EI; EIA; ELANH2; LEI; M/NEI; MNEI; PI2
• Summary: Neutrophil serine protease inhibitor that plays an essential role in the regulation of the innate immune response, inflammation and cellular homeostasis (PubMed:17664292, PubMed:21683252, PubMed:21248149, PubMed:30692621). Acts primarily to protect the cell from proteases released in the cytoplasm during stress or infection (PubMed:17664292). These proteases are important in killing microbes but when released from granules, these potent enzymes also destroy host proteins and contribute to mortality. Regulates the activity of the neutrophil proteases elastase, cathepsin G, proteinase-3, chymase, chymotrypsin, and kallikrein-3. Acts also as a potent intracellular inhibitor of granzyme H (PubMed:12189154). During inflammation, limits the activity of inflammatory caspases CASP1 and CASP4 by suppressing their caspase-recruitment domain (CARD) oligomerization and enzymatic activation (PubMed:30692621). In addition, promotes the proliferation of beta-cells when secreted (PubMed:26701651).[UniProtKB/Swiss-Prot Function]