1110004E09Rik (NM_026502) Mouse Recombinant Protein
CAT#: TP503964
Purified recombinant protein of Mouse cilia and flagella associate protien 298 (Cfap298), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Product Images
Frequently bought together (1)
Other products for "1110004E09Rik"
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR203964 protein sequence
Red=Cloning site Green=Tags(s) MVVLHVKRGDESQFLLQAPGSTELEELTAQVARVYNGRLKVHRLCSEMEELAEHGVFLHPNMQGLTDEQI EELKLKDEWGEKCVPSGGSVFTKDEIGRRNGQAPNEKMKQVLKKTVEEAKAIVSKKQVEAGVFVTMEMVK DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAALEVIQESEAQLWWAAKELRRTKKLSDYVGK NEKTKIIVKIQQRGQGAPAREPVISSEEHKQLMLFYHRRQEELKKLEENDDDSCLNSPWADNTALKRHFH GVKDIKWRPR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 33.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_080778 |
Locus ID | 68001 |
UniProt ID | Q8BL95 |
Cytogenetics | 16 C3.3 |
Refseq Size | 1163 |
Refseq ORF | 873 |
Summary | Plays a role in motile cilium function, possibly by acting on outer dynein arm assembly. Seems to be important for initiation rather than maintenance of cilium motility. Required for correct positioning of cilia at the apical cell surface, suggesting an additional role in the planar cell polarity (PCP) pathway. May suppress canonical Wnt signaling activity.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.