BRUNOL5 (CELF5) (NM_001172673) Human Recombinant Protein
CAT#: TP330024
Recombinant protein of human CUGBP, Elav-like family member 5 (CELF5), transcript variant 2, 20 µg
View other "BRUNOL5" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC230024 representing NM_001172673
Red=Cloning site Green=Tags(s) MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGR IYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGM LNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVK FADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQI GAVSLNGLPATPIAPASGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAI TPIAHSVPQPPPLLQQQQREGVWRHGADADVPTLRQYHFLQGVYGSSYQPEQVFRLREL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 44.9 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001166144 |
Locus ID | 60680 |
UniProt ID | Q8N6W0 |
Cytogenetics | 19p13.3 |
Refseq ORF | 1227 |
Synonyms | BRUNOL-5; BRUNOL5; CELF-5 |
Summary | This gene encodes a member of the the CELF/BRUNOL protein family, which contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing and translation. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411870 | CELF5 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY411870 | Transient overexpression lysate of bruno-like 5, RNA binding protein (Drosophila) (BRUNOL5) |
USD 436.00 |
|
PH307072 | CELF5 MS Standard C13 and N15-labeled recombinant protein (NP_068757) |
USD 3,255.00 |
|
TP307072 | Recombinant protein of human bruno-like 5, RNA binding protein (Drosophila) (BRUNOL5), 20 µg |
USD 867.00 |
{0} Product Review(s)
Be the first one to submit a review